Protein Info for DDA3937_RS04525 in Dickeya dadantii 3937

Annotation: NADH:flavorubredoxin reductase NorW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 PF07992: Pyr_redox_2" amino acids 4 to 278 (275 residues), 203.8 bits, see alignment E=2e-63 PF13738: Pyr_redox_3" amino acids 37 to 272 (236 residues), 53 bits, see alignment E=1.6e-17 PF00070: Pyr_redox" amino acids 143 to 220 (78 residues), 60.8 bits, see alignment E=7.6e-20 PF18113: Rbx_binding" amino acids 317 to 385 (69 residues), 64.3 bits, see alignment E=3.4e-21

Best Hits

Swiss-Prot: 61% identical to NORW_PECAS: Nitric oxide reductase FlRd-NAD(+) reductase (norW) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K12265, nitric oxide reductase FlRd-NAD(+) reductase [EC: 1.18.1.-] (inferred from 100% identity to ddd:Dda3937_01435)

Predicted SEED Role

"Nitric oxide reductase FlRd-NAD(+) reductase (EC 1.18.1.-)" in subsystem Nitrosative stress (EC 1.18.1.-)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.18.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SB57 at UniProt or InterPro

Protein Sequence (387 amino acids)

>DDA3937_RS04525 NADH:flavorubredoxin reductase NorW (Dickeya dadantii 3937)
MSDDIIVIGAGFAARQLIKNLRKQDTQRPIRLITADSGDEYNKPELSHVISQHRPADDLT
RMSAAQFAEEQRITLLAHTSVTGIDAGRRQVICDTRHYDYHTLVLATGASAVIPPVPGHE
WMLTLNSQQEYRRAETRLTQATRILILGAGLIGSELAMDMAQAGKHVTLVDRASHLLSAL
LPVDISARLQDALLRQGVELMLNSGLQRLEKTDAGLEVTLMSGRTLEVDEVISAIGLRAN
TSLATAAGLTVNRGIVTDSQMRTSDPHIYALGDCAEINGKLLPFLQPIQLTANIAASSII
TSTSNTADQIRGGNGSLTLPAMLIKVKTPLFPLQLAGETQNPELVWHTIADRGGIVAKGM
EGEQLRGFVVGGDRMKDAFPLLRQLSS