Protein Info for DDA3937_RS04495 in Dickeya dadantii 3937

Annotation: sulfate transporter CysZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 transmembrane" amino acids 32 to 52 (21 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details amino acids 210 to 242 (33 residues), see Phobius details PF07264: EI24" amino acids 16 to 232 (217 residues), 207.5 bits, see alignment E=1.2e-65

Best Hits

Swiss-Prot: 78% identical to CYSZ_PECAS: Sulfate transporter CysZ (cysZ) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K06203, CysZ protein (inferred from 100% identity to ddd:Dda3937_01429)

MetaCyc: 77% identical to sulfate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-586

Predicted SEED Role

"Sulfate transporter, CysZ-type" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SB51 at UniProt or InterPro

Protein Sequence (256 amino acids)

>DDA3937_RS04495 sulfate transporter CysZ (Dickeya dadantii 3937)
MSYTQHLDPKHSGLHYFLKGWQLLSLPGIRRFVILPMLVNILLMGGAFWWLFHQLGTWIP
QLMTHVPDWLQWLSYLLWPLVTLSVLLVFSYFFSTITNLIAAPFNGLLAEQLEARLTGQP
LPASGILDIAKDVPRIMRREIQKLAYYLPRVLVLLLLYFVPGIGQTVVPVVWFLFGAWML
AIQYCDYPFDNHKVGFSAMRQALRQNKLTNLQFGALVSLCTMVPVLNLLIMPVAVCGATA
LWVDRYRHLSDTLHRS