Protein Info for DDA3937_RS04470 in Dickeya dadantii 3937

Annotation: helix-turn-helix transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 signal peptide" amino acids 12 to 19 (8 residues), see Phobius details PF01638: HxlR" amino acids 20 to 101 (82 residues), 78.2 bits, see alignment E=1.7e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_01424)

Predicted SEED Role

"transcriptional regulator, MarR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SB45 at UniProt or InterPro

Protein Sequence (184 amino acids)

>DDA3937_RS04470 helix-turn-helix transcriptional regulator (Dickeya dadantii 3937)
MRSKGFDGMVCSIAGVMAAIGDRWGLLIIRDLVFGISRYDELRQSSGVTNATLSNRLKHL
EANGLVERRRYQVNPERFEYLLTPHGQQLAPVMVVLSQIGDGLGLSGASVPPLKFVNRKT
GADVRWSFIDQKTGEPLSSEDIAFAEGPGADDLVRWRLSHTNRRYEGDTTTLLSENSISE
PKTK