Protein Info for DDA3937_RS04400 in Dickeya dadantii 3937

Annotation: glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details TIGR01426: glycosyltransferase, MGT family" amino acids 10 to 421 (412 residues), 123.9 bits, see alignment E=4.3e-40 PF00201: UDPGT" amino acids 212 to 399 (188 residues), 26.8 bits, see alignment E=3.5e-10 PF06722: EryCIII-like_C" amino acids 282 to 419 (138 residues), 72.5 bits, see alignment E=5.7e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_01408)

MetaCyc: 57% identical to rhabduscin glycosyltransferase (Xenorhabdus nematophila ATCC 19061)
2.4.1.-

Predicted SEED Role

"N-glycosyltransferase"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SB29 at UniProt or InterPro

Protein Sequence (424 amino acids)

>DDA3937_RS04400 glycosyltransferase (Dickeya dadantii 3937)
MSHILMAAVATPGHVYPMLTIARHLLTKGHRVTLFSGALFREQAQAAGVGFIAFDEAIDF
DYRYLERHFPRRATLPPGNAQMALALREFFSAPIPLIDRQLRAVLAQTGADVVMAENCFY
GILPLLASEDRPPVIGIGVTPLSFSSRDSIFYGPRIPPALLPPDLTREQLIDDETRELIA
GVKEAFDTVMVQSGQQPLTAPFADALISGCDRFLQLSTTELEYHRDDLPSCVRFVGPLPL
KVTEEDAEQALWPPQDNRPLVIVSQGTLANVDLQQLIGPTLRALADLPVRVLATTGGRPV
EALAASVPENARVCRFVSLEHWLPRAALLITNGGYGSLNAALSHGVPLIVAGTGEDKLET
AARVVFAGCGLNLGTSTPGEQQIADAVTRILEQPGYTQRARWVQADCARHHALEAIAEEV
AAIG