Protein Info for DDA3937_RS03815 in Dickeya dadantii 3937

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 41 to 357 (317 residues), 195.7 bits, see alignment E=4.8e-62 PF16576: HlyD_D23" amino acids 62 to 261 (200 residues), 40 bits, see alignment E=4.2e-14 PF13533: Biotin_lipoyl_2" amino acids 67 to 108 (42 residues), 30.3 bits, see alignment 4.4e-11 PF13437: HlyD_3" amino acids 172 to 263 (92 residues), 26.8 bits, see alignment E=1.1e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_01224)

Predicted SEED Role

"RND efflux membrane fusion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SMQ4 at UniProt or InterPro

Protein Sequence (371 amino acids)

>DDA3937_RS03815 efflux RND transporter periplasmic adaptor subunit (Dickeya dadantii 3937)
MARRRLLSFAVICALPFALAACGEKTSSDPRTQAPLVRSATIQGSEVESRTFTGTIAARI
ESDLGFRVSGKVLERLVDTGQAVKRGQPLMRLDPIDLELAARAQQEAVVAARARALQTAE
DEARYRDLRGTGAISSSAYDQVKAAADAAKAQLSAAQAQADVARNASRYAVLVADGDGIV
MDTLAEPGQVVSAGQTVVRLAQAGQREAIIQLPETLRPALGSTGLATRFGQAGTGSPATL
RQLSNTADKLTRTFEARYVLQGELANAPLGTTVMIRIPDQQSATQGSLQVPLAALFDAGK
GPGVWVIHGEPATVTWRPVTIQNMSDDTARVTGQIQQGEQIVALGAHLLREGEPVRVADV
AATTAAAGGRP