Protein Info for DDA3937_RS03675 in Dickeya dadantii 3937

Annotation: 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione acylhydrolase (decyclizing)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR04377: 3,5/4-trihydroxycyclohexa-1,2-dione hydrolase
  • amino acids 5 to 641 (637 residues), 930.9 bits, E=2e-284
• PF02776: TPP_enzyme_N
  • amino acids 6 to 134 (129 residues), 53.5 bits, E=3.2e-18
• PF00205: TPP_enzyme_M
  • amino acids 220 to 353 (134 residues), 111.1 bits, E=5.3e-36
• PF02775: TPP_enzyme_C
  • amino acids 439 to 598 (160 residues), 131.3 bits, E=3.9e-42

Best Hits

Swiss-Prot: 60% identical to IOLD_GEOKA: 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase (iolD) from Geobacillus kaustophilus (strain HTA426)

KEGG orthology group: K03336, 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [EC: 3.7.1.-] (inferred from 100% identity to ddd:Dda3937_01198)

Predicted SEED Role

"Epi-inositol hydrolase (EC 3.7.1.-)" in subsystem Inositol catabolism (EC 3.7.1.-)

MetaCyc Pathways

• myo-inositol degradation I (6/7 steps found)
• myo-, chiro- and scyllo-inositol degradation (6/10 steps found)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Caprolactam degradation
• Ethylbenzene degradation
• Inositol phosphate metabolism
• Limonene and pinene degradation
• Nicotinate and nicotinamide metabolism
• Phenylalanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.7.1.-

Use Curated BLAST to search for 3.7.1.-

Sequence Analysis Tools

See E0SMM5 at UniProt or InterPro

Protein Sequence (643 amino acids)

>DDA3937_RS03675 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione acylhydrolase (decyclizing) (Dickeya dadantii 3937)
MDTLKMTMAQALVRFLNQQYLDVDGEQTPLFAGVMTIFGHGNVLGIGQALEQDAGHLQVH
QGCNEQGMAHIAVGFAKQHRRRRVYAVTTSVGPGSANLVTAAATATANRIPLLLLPGDLF
ASRQPDPVLQQIEQYHDATISTNDCLRPVSRYWDRISRPEQLMSALINAMRVLTDPADTG
TVTLCLPQDVQAEAWDYPAAFFQRRVHHLERRPPDVARLAQATALLARKRRPLLICGGGV
RYAGAHDAFQQFAERFNLPFGETQAGKGALVSTHPLNAGGIGVTGGQAANRLAAQADLVI
GVGTRLTDFTTASKSLFTHPQVEFLLLNVAEFDAFKLDATALIADAREGLTQLTQALDAQ
GYRSGWGDEIAQASLDWQRERQRLFDRRDEDGQGLEIAGHLDAQLAEYRETLGTRLTQTR
VLGLLNDALEDDAIVVGAAGSLPGDLQRLWQVKTPDSYHLEYGYSCMGYEIAAAVGARLA
APRQPVYAMVGDGSYLMLHSELQTAVQEGIKITVLLFDNAGFGCINNLQMSQGMGSFCTE
NRRRDRDSGKLTGSLVTVDFARNAESYGCRAWTVRDEASLLQALREAQAHSGPCLLDIKV
LPKTMTHGYDAWWNTGTAQVADKPAIEAAAREVRLQRSKARQY