Protein Info for DDA3937_RS03590 in Dickeya dadantii 3937

Annotation: LysE family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 42 to 66 (25 residues), see Phobius details amino acids 72 to 94 (23 residues), see Phobius details amino acids 125 to 174 (50 residues), see Phobius details amino acids 187 to 205 (19 residues), see Phobius details PF01810: LysE" amino acids 18 to 206 (189 residues), 120.3 bits, see alignment E=3.8e-39

Best Hits

KEGG orthology group: K05835, threonine efflux protein (inferred from 100% identity to ddd:Dda3937_01179)

Predicted SEED Role

"L-lysine permease" in subsystem Lysine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SMK6 at UniProt or InterPro

Protein Sequence (207 amino acids)

>DDA3937_RS03590 LysE family transporter (Dickeya dadantii 3937)
MASDILAIAAIGGVLALGAMSPGQSFILVARTALASSRRTSLAVSLGMGAGAAIFALIAL
LGLQSLLLAVPWLYQVLKIAGGCYLLYLAFTLFRARPHHTAPTLRDDPAPPPTHAFRLGL
LTQLSNPNTALVFGGVFAALLSQHIAGWMYVALPLLAFVIDFLWYALVALLLSSSRPRSA
YLRFKTVFDRLSGTVIAALGIRLLLQK