Protein Info for DDA3937_RS03415 in Dickeya dadantii 3937

Annotation: NAD-dependent epimerase/dehydratase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 PF04321: RmlD_sub_bind" amino acids 1 to 198 (198 residues), 61.8 bits, see alignment E=2.1e-20 PF01370: Epimerase" amino acids 3 to 219 (217 residues), 126.4 bits, see alignment E=4.4e-40 PF16363: GDP_Man_Dehyd" amino acids 4 to 296 (293 residues), 41.5 bits, see alignment E=4.2e-14 PF01073: 3Beta_HSD" amino acids 4 to 255 (252 residues), 76.2 bits, see alignment E=7.9e-25 PF13460: NAD_binding_10" amino acids 7 to 166 (160 residues), 46.7 bits, see alignment E=1.2e-15 PF02719: Polysacc_synt_2" amino acids 51 to 243 (193 residues), 21.7 bits, see alignment E=3.6e-08 PF07993: NAD_binding_4" amino acids 51 to 187 (137 residues), 52.8 bits, see alignment E=1.2e-17

Best Hits

Swiss-Prot: 51% identical to GALE_VIBCL: UDP-glucose 4-epimerase (galE) from Vibrio cholerae

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_02273)

MetaCyc: 54% identical to UDP-N-acetyl-alpha-D-quinovosamine dehydrogenase (Pseudomonas aeruginosa)
RXN-14767 [EC: 1.1.1.426]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 1.1.1.426 or 5.1.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SLS9 at UniProt or InterPro

Protein Sequence (324 amino acids)

>DDA3937_RS03415 NAD-dependent epimerase/dehydratase family protein (Dickeya dadantii 3937)
MKILVTGSRGFIGRRLVALAGEQGITCVPHCSERGEASDGSMIRADLTATTDWMPALQGV
DAVVHCAARVHQMQDGGEALQLYRETNVAGTLRLAQQAADAGVKRLVFLSSIKVNGEATQ
PGRPFQPDVAVPPADPYGLSKYEAEQGLLRLARETGLEVVIIRPPLVYGPGVKANFRAMM
NWVSKGVPLPLAAVHNQRSLVFVDNLADLILLSVRHPQAPGRVWLASDDHDVSTADLLAD
MAAALGVKNRCWPLPPWMLKSAATLLGKSAVAERLLGSLQVDIRETRQRLGWRPVVPYHQ
AMAITARAFLAETSGVPESESKQG