Protein Info for DDA3937_RS03310 in Dickeya dadantii 3937

Annotation: single-stranded-DNA-specific exonuclease RecJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 576 transmembrane" amino acids 187 to 199 (13 residues), see Phobius details TIGR00644: single-stranded-DNA-specific exonuclease RecJ" amino acids 23 to 572 (550 residues), 534.2 bits, see alignment E=1.5e-164 PF01368: DHH" amino acids 72 to 232 (161 residues), 87.1 bits, see alignment E=1.9e-28 PF02272: DHHA1" amino acids 321 to 451 (131 residues), 87.6 bits, see alignment E=1.6e-28 PF17768: RecJ_OB" amino acids 468 to 572 (105 residues), 76 bits, see alignment E=3.4e-25

Best Hits

Swiss-Prot: 100% identical to RECJ_DICD3: Single-stranded-DNA-specific exonuclease RecJ (recJ) from Dickeya dadantii (strain 3937)

KEGG orthology group: K07462, single-stranded-DNA-specific exonuclease [EC: 3.1.-.-] (inferred from 100% identity to ddd:Dda3937_02294)

MetaCyc: 76% identical to ssDNA-specific exonuclease RecJ (Escherichia coli K-12 substr. MG1655)
Exodeoxyribonuclease VII. [EC: 3.1.11.6]

Predicted SEED Role

"Single-stranded-DNA-specific exonuclease RecJ (EC 3.1.-.-)" in subsystem DNA-replication or DNA Repair Base Excision or DNA repair, bacterial RecFOR pathway (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-, 3.1.11.6

Use Curated BLAST to search for 3.1.-.- or 3.1.11.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P39693 at UniProt or InterPro

Protein Sequence (576 amino acids)

>DDA3937_RS03310 single-stranded-DNA-specific exonuclease RecJ (Dickeya dadantii 3937)
MNVVTQLRRRPTAETELPDSLPALLRRLYAQRGVRQMQELERSLRGLLDYRLLGGITQAV
EVLRQALADNRRIVIVGDFDADGATSTALTVLALRSMGGREVQYLVPNRFEDGYGLSPEV
VAQAAAKGAELIVTVDNGISSHAGVDDAHRRGIAVVVTDHHLPGETLPAAEAMINPNLSD
CAFPSKALAGVGVAFYLMMALRANLRECGWFAERGLAEPNLAELLDLVALGTVADVVPLD
ANNRILISQGLSRIRAGKCRPGIRALLEVSNRDAAQLVASDLGFALGPRLNAAGRLDDMS
VGVELLLCNDIVQARMLASDLDALNQSRREIEAGMQVEALHLCEQLERSRDTLPLGLAMY
HPQWHQGVVGILASRIKERFHRPVIAFAPAGDGILKGSGRSIAGLHLRDALERLDTCHPG
LMLKFGGHAMAAGLSLVEDRFDEFRQRFADLVGEWLDASQLEGVVWSDGELASPELTLGT
AEMLREAGPWGQAFPEPTFDGRFRLLQQRLVGERHLKVMVEPLGGGPLLDGIAFNVDTLL
WPDSSVREVELAYKLDVNEFRGKRSVQLLIEHLWPL