Protein Info for DDA3937_RS03285 in Dickeya dadantii 3937

Annotation: protein YgfX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 39 to 56 (18 residues), see Phobius details PF07254: Cpta_toxin" amino acids 2 to 132 (131 residues), 161.3 bits, see alignment E=7e-52

Best Hits

Swiss-Prot: 71% identical to YGFX_SERS3: Inner membrane protein YgfX (ygfX) from Serratia sp. (strain ATCC 39006)

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_02300)

Predicted SEED Role

"FIG00731769: possible membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SLQ1 at UniProt or InterPro

Protein Sequence (143 amino acids)

>DDA3937_RS03285 protein YgfX (Dickeya dadantii 3937)
MAQWQCDLRVSWRMQLFSLLTHGFLVLMILLAPWPDGYAPLWLGLVTLVVFGFVFSQRII
KTRQGEISLHGENQLHWQQRDWQIVRRPWLMRNGVLLSLRAVDGKGHQRLWLASDSMGNE
EWRLLRQLLQQHSLQGTESSHHH