Protein Info for DDA3937_RS03025 in Dickeya dadantii 3937
Annotation: 23S rRNA (uridine(2552)-2'-O)-methyltransferase RlmE
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 93% identical to RLME_SALTI: Ribosomal RNA large subunit methyltransferase E (rlmE) from Salmonella typhi
KEGG orthology group: K02427, ribosomal RNA large subunit methyltransferase E [EC: 2.1.1.-] (inferred from 99% identity to ddc:Dd586_0593)MetaCyc: 93% identical to 23S rRNA 2'-O-ribose U2552 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11845 [EC: 2.1.1.166]
Predicted SEED Role
"Heat shock protein FtsJ/RrmJ @ Ribosomal RNA large subunit methyltransferase E (EC 2.1.1.-)" (EC 2.1.1.-)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Anthocyanin biosynthesis
- Benzoxazinone biosynthesis
- Biosynthesis of alkaloids derived from shikimate pathway
- Carotenoid biosynthesis - General
- Flavonoid biosynthesis
- Histidine metabolism
- Insect hormone biosynthesis
- Naphthalene and anthracene degradation
- Phenylpropanoid biosynthesis
- Porphyrin and chlorophyll metabolism
- Tryptophan metabolism
- Tyrosine metabolism
- Ubiquinone and menaquinone biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 2.1.1.-
Use Curated BLAST to search for 2.1.1.- or 2.1.1.166
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See E0SKX3 at UniProt or InterPro
Protein Sequence (209 amino acids)
>DDA3937_RS03025 23S rRNA (uridine(2552)-2'-O)-methyltransferase RlmE (Dickeya dadantii 3937) MANKKRSASSSRWLQEHFSDKYVQQAQKKGLRSRAWFKLDEIQQTDRLFKPGMTVVDLGA APGGWSQYVVSQIGGKGRIIACDLLPMDPIVGVDFLQGDFRDELVLKTLLERVGDEKVQV VMSDMAPNMSGTPEVDIPRAMYLVELALDMCRDILAPGGSFVVKVFQGVGFDEYLREIRS LFTTVKIRKPDASRARSREVYIVATGRKL