Protein Info for DDA3937_RS02765 in Dickeya dadantii 3937

Annotation: zinc uptake transcriptional repressor Zur

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 169 PF01475: FUR" amino acids 20 to 138 (119 residues), 56.5 bits, see alignment E=1.6e-19

Best Hits

Swiss-Prot: 70% identical to ZUR_ECOLI: Zinc uptake regulation protein (zur) from Escherichia coli (strain K12)

KEGG orthology group: K09823, Fur family transcriptional regulator, zinc uptake regulator (inferred from 100% identity to ddd:Dda3937_02727)

Predicted SEED Role

"Zinc uptake regulation protein ZUR" in subsystem Oxidative stress or Transport of Zinc

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SK39 at UniProt or InterPro

Protein Sequence (169 amino acids)

>DDA3937_RS02765 zinc uptake transcriptional repressor Zur (Dickeya dadantii 3937)
MDSTNPDKLVAQAEQLCQQRNVRLTPQRQEVLRLMAQQPGAISAYDLLDLLRVSEPQAKP
PTVYRALDFLLEQGFIHKVESTNSYVLCHHFEEHSHTSALFICDRCGLVTERQTEGVEET
LHQLAKQSGFALRHSVVEAHGLCGECQKVESCEHRDSCNHDHSILVKKR