Protein Info for DDA3937_RS02760 in Dickeya dadantii 3937

Annotation: repressor LexA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 TIGR00498: repressor LexA" amino acids 1 to 200 (200 residues), 275.2 bits, see alignment E=1.6e-86 PF01726: LexA_DNA_bind" amino acids 1 to 65 (65 residues), 99.8 bits, see alignment E=5.7e-33 PF00717: Peptidase_S24" amino acids 78 to 194 (117 residues), 117 bits, see alignment E=3.9e-38

Best Hits

Swiss-Prot: 91% identical to LEXA_PECCP: LexA repressor (lexA) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K01356, repressor LexA [EC: 3.4.21.88] (inferred from 98% identity to ddc:Dd586_0541)

Predicted SEED Role

"SOS-response repressor and protease LexA (EC 3.4.21.88)" in subsystem DNA repair, bacterial (EC 3.4.21.88)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.88

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SK38 at UniProt or InterPro

Protein Sequence (203 amino acids)

>DDA3937_RS02760 repressor LexA (Dickeya dadantii 3937)
MKALTTRQQQVYDLIRDHISQTGMPPTRAEIASQLGFRSPNAAEEHLKALARKGVIEIVT
GASRGIRLLMEEEDQGLPLIGRVAAGEPLLAQQHIECHYQVDPAMFKPSADFLLRVSGMS
MKDIGILDGDLLAVHKTQDVRNGQVVVARIEDEVTVKRLKKQGNVVQLLAENKEFAPIVV
DLREQSFSIEGLAVGVIRNSDWS