Protein Info for DDA3937_RS02755 in Dickeya dadantii 3937
Annotation: diacylglycerol kinase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 62% identical to KDGL_ECOL6: Diacylglycerol kinase (dgkA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
KEGG orthology group: K00901, diacylglycerol kinase [EC: 2.7.1.107] (inferred from 100% identity to ddd:Dda3937_02725)MetaCyc: 62% identical to diacylglycerol kinase (Escherichia coli K-12 substr. MG1655)
Diacylglycerol kinase. [EC: 2.7.1.107]
Predicted SEED Role
"Diacylglycerol kinase (EC 2.7.1.107)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.1.107)
MetaCyc Pathways
- phosphatidate metabolism, as a signaling molecule (2/5 steps found)
- diacylglycerol and triacylglycerol biosynthesis (3/7 steps found)
- type I lipoteichoic acid biosynthesis (S. aureus) (5/17 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.7.1.107
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See E0SK37 at UniProt or InterPro
Protein Sequence (121 amino acids)
>DDA3937_RS02755 diacylglycerol kinase (Dickeya dadantii 3937) MNKTTGITRIIKAAGYSLQGLQQAWRHEAAFRQESLLTLAAIIIACWLPVAMVERLLLIG SVVLIVLFELVNSAIEAVVDRIGMDYHELSGRAKDIGSAAVFVACLLAAGVWGAILWNRF A