Protein Info for DDA3937_RS02755 in Dickeya dadantii 3937

Annotation: diacylglycerol kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01219: DAGK_prokar
  • amino acids 15 to 116 (102 residues), 120.4 bits, E=1.4e-39

Best Hits

Swiss-Prot: 62% identical to KDGL_ECOL6: Diacylglycerol kinase (dgkA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00901, diacylglycerol kinase [EC: 2.7.1.107] (inferred from 100% identity to ddd:Dda3937_02725)

MetaCyc: 62% identical to diacylglycerol kinase (Escherichia coli K-12 substr. MG1655)
Diacylglycerol kinase. [EC: 2.7.1.107]

Predicted SEED Role

"Diacylglycerol kinase (EC 2.7.1.107)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.1.107)

MetaCyc Pathways

• phosphatidate metabolism, as a signaling molecule (2/5 steps found)
• diacylglycerol and triacylglycerol biosynthesis (3/7 steps found)
• type I lipoteichoic acid biosynthesis (S. aureus) (5/17 steps found)

KEGG Metabolic Maps

• Glycerolipid metabolism
• Glycerophospholipid metabolism
• Phosphatidylinositol signaling system

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.107

Sequence Analysis Tools

See E0SK37 at UniProt or InterPro

Protein Sequence (121 amino acids)

>DDA3937_RS02755 diacylglycerol kinase (Dickeya dadantii 3937)
MNKTTGITRIIKAAGYSLQGLQQAWRHEAAFRQESLLTLAAIIIACWLPVAMVERLLLIG
SVVLIVLFELVNSAIEAVVDRIGMDYHELSGRAKDIGSAAVFVACLLAAGVWGAILWNRF
A