Protein Info for DDA3937_RS02630 in Dickeya dadantii 3937

Annotation: TIGR04141 family sporadically distributed protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 579 PF19614: DUF6119" amino acids 17 to 577 (561 residues), 420.9 bits, see alignment E=3.8e-130 TIGR04141: sporadically distributed protein, TIGR04141 family" amino acids 18 to 576 (559 residues), 354.1 bits, see alignment E=5.6e-110

Best Hits

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_02702)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SK11 at UniProt or InterPro

Protein Sequence (579 amino acids)

>DDA3937_RS02630 TIGR04141 family sporadically distributed protein (Dickeya dadantii 3937)
MEKPEIENDDNLKSQTLTIRLLKKDIPIENALSIDHGYLPQETVRGELYTDQSESAPPTW
GKFLGDFSRSDLSELSNKHCSAVLFIEVPPTNEKNDTRIMALTFGYGHHALEISAFERNF
GLKVTLSAVTRTELVSLDTATLDSTVFQRRIQASKKANFSGFGMNIERDLLRLAGGIPSD
TSFASALVGKDALTITARTSPDDFLSKCSKALDLFYSNKYKNEFSFIDHITPVYNSEHKD
YLDSIIFSEISSLVGGGASDLHMVIPEVTNPEFSHEISYYGAGFGKGTKKHFPGVDINDY
ISELSSGDFNSIQTFEEIRKGQYIFEIQNGEKNKKSKRKVYDCLVFEVEVNNLNLMPDSS
TASPINSLSNVPADLPEGVYVLFSGNWYLVDKEFHTRIENSYLKYLTKSFLPNTKMKNER
ALILDLNKSSELLNLDQVKINPTGTSNANIEPCDFLSTKCQFIHLKDGESSGPISHLWNQ
GVVSAEAYLNDMKFRRDLNKEIKKRQREFNKSGFDSLLPRANGKLDTNKITVVFGVMRTP
YVKTSQAGLPFFSKVSFRPVAQAIESMGYKVELHLIEKI