Protein Info for DDA3937_RS02445 in Dickeya dadantii 3937

Annotation: peptide chain release factor 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 529 TIGR00503: peptide chain release factor 3" amino acids 5 to 529 (525 residues), 1052.6 bits, see alignment E=0 PF00009: GTP_EFTU" amino acids 12 to 277 (266 residues), 161.5 bits, see alignment E=4.4e-51 TIGR00231: small GTP-binding protein domain" amino acids 14 to 164 (151 residues), 66.2 bits, see alignment E=3e-22 PF01926: MMR_HSR1" amino acids 17 to 143 (127 residues), 22.9 bits, see alignment E=1.9e-08 PF22042: EF-G_D2" amino acids 295 to 381 (87 residues), 89.3 bits, see alignment E=3.7e-29 PF03144: GTP_EFTU_D2" amino acids 314 to 380 (67 residues), 50.9 bits, see alignment E=4.5e-17 PF16658: RF3_C" amino acids 387 to 514 (128 residues), 157.7 bits, see alignment E=3.5e-50

Best Hits

Swiss-Prot: 94% identical to RF3_PECCP: Peptide chain release factor 3 (prfC) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K02837, peptide chain release factor 3 (inferred from 100% identity to ddd:Dda3937_02672)

Predicted SEED Role

"Peptide chain release factor 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SJW9 at UniProt or InterPro

Protein Sequence (529 amino acids)

>DDA3937_RS02445 peptide chain release factor 3 (Dickeya dadantii 3937)
MSPSEYAREVSKRRTFAIISHPDAGKTTITEKVLLFGQAIQVAGTVKGRGSSQHAKSDWM
EMEKQRGISITTSVMQFPYRECLVNLLDTPGHEDFSEDTYRTLTAVDCCLMVIDAAKGVE
DRTRKLMEVTRLRDTPILTFMNKLDRDIRDPMEVLDEVESELNIACAPITWPIGCGKLFK
GVYHLYKDETYLYQSGMGHTIQAVRIVKGLDNPELDQAVGEDLAAQLRDELELVKGASHE
FEQDAFLNGELTPVFFGTALGNFGVDHMLDGLVAWAPTPMPRKTDARVVSADEEKFSGFV
FKIQANMDPKHRDRVAFMRVVSGRYEKGMKLRQVRTGKDVVISDALTFMAGDRSHVEEAY
PGDIIGLHNHGTIQIGDTFTQGEDLKFTGIPNFAPELFRRIRLRDPLKQKQLLKGLVQLS
EEGAVQVFRPLINNDLIVGAVGVLQFDVVVARLKTEYNVEAIYESVNVSTARWVECGDVK
KFEEFKRKNEQYLALDGGDNLAYVAPTMVNLNLAQERYPDVKFHKTREH