Protein Info for DDA3937_RS02430 in Dickeya dadantii 3937

Annotation: YtjB family periplasmic protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 164 to 184 (21 residues), see Phobius details PF10144: SMP_2" amino acids 1 to 160 (160 residues), 240 bits, see alignment E=4.9e-76

Best Hits

Swiss-Prot: 72% identical to SMP_YERPE: Protein Smp (smp) from Yersinia pestis

KEGG orthology group: K07186, membrane protein (inferred from 100% identity to ddd:Dda3937_02675)

Predicted SEED Role

"Lipoate-protein ligase A" in subsystem Lipoic acid metabolism

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SJ77 at UniProt or InterPro

Protein Sequence (226 amino acids)

>DDA3937_RS02430 YtjB family periplasmic protein (Dickeya dadantii 3937)
MVRARIKFRLHRTAIVLICLALLVVLLQGASYFSLSHQMARSEQVEELARTLVRQVAFGL
TPLMESNSDNSGRIEETLRQLTDHSRILDAALYQQDGTLVARAGEQIEVRDRLALDGSRA
GSYFNHQLVEPVNSKDGPIGFLRITLDTHVLATEARQVDNTTNILRLMVLMALAIGIILA
RTLLQHRRSRWQQSPYLLTANAPVQDDEPANDDEPSAQDGDQTRKP