Protein Info for DDA3937_RS02410 in Dickeya dadantii 3937

Annotation: 5-formyltetrahydrofolate cyclo-ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 PF01812: 5-FTHF_cyc-lig" amino acids 17 to 198 (182 residues), 162.2 bits, see alignment E=6.9e-52 TIGR02727: 5-formyltetrahydrofolate cyclo-ligase" amino acids 17 to 198 (182 residues), 179.7 bits, see alignment E=2.7e-57

Best Hits

Swiss-Prot: 68% identical to 5FCL_ECO57: 5-formyltetrahydrofolate cyclo-ligase (ygfA) from Escherichia coli O157:H7

KEGG orthology group: K01934, 5-formyltetrahydrofolate cyclo-ligase [EC: 6.3.3.2] (inferred from 100% identity to ddd:Dda3937_02679)

MetaCyc: 68% identical to putative 5-formyltetrahydrofolate cyclo-ligase (Escherichia coli K-12 substr. MG1655)
5-formyltetrahydrofolate cyclo-ligase. [EC: 6.3.3.2]

Predicted SEED Role

"5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2)" in subsystem Folate Biosynthesis or One-carbon metabolism by tetrahydropterines or Serine-glyoxylate cycle (EC 6.3.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SJ73 at UniProt or InterPro

Protein Sequence (204 amino acids)

>DDA3937_RS02410 5-formyltetrahydrofolate cyclo-ligase (Dickeya dadantii 3937)
MNPASAASDLFSITALRQQIRQQVRQRRRALSREQQAIFAGQAAERAMAHPRLGDARRVA
LFLSFDGELDTQPLIEALWQRQKQVYLPVLHPFCNGHLLFLRYAPDSELVWNRLKIQEPR
LDVRQVLPVERLDVLLTPLVAFDAAGQRLGMGGGFYDRTLQHWQSRGPYPIGLAHDCQQV
DALPVESWDVPLPEIITPSRHWRW