Protein Info for DDA3937_RS02385 in Dickeya dadantii 3937

Annotation: FAD-dependent 2-octaprenylphenol hydroxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 signal peptide" amino acids 6 to 20 (15 residues), see Phobius details transmembrane" amino acids 21 to 29 (9 residues), see Phobius details PF01494: FAD_binding_3" amino acids 5 to 345 (341 residues), 98.7 bits, see alignment E=4.3e-32 TIGR01988: ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family" amino acids 5 to 391 (387 residues), 439.4 bits, see alignment E=5.2e-136 PF08491: SE" amino acids 276 to 361 (86 residues), 22.2 bits, see alignment E=7.1e-09

Best Hits

Swiss-Prot: 73% identical to UBII_ECOLI: 2-octaprenylphenol hydroxylase (ubiI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_02684)

MetaCyc: 73% identical to 2-octaprenylphenol 6-hydroxylase (Escherichia coli K-12 substr. MG1655)
2-OCTAPRENYLPHENOL-HYDROX-RXN [EC: 1.14.13.240]

Predicted SEED Role

"2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase (EC 1.14.13.-)" in subsystem Ubiquinone Biosynthesis (EC 1.14.13.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.- or 1.14.13.240

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SJ68 at UniProt or InterPro

Protein Sequence (403 amino acids)

>DDA3937_RS02385 FAD-dependent 2-octaprenylphenol hydroxylase (Dickeya dadantii 3937)
MQSFDVVIAGGGMVGLALACGLQGSGLSVAVLEKQTTTEPLANGPHALRVSAINAASEAL
LRKLNVWPGIAAQRLSPYNEMYVWDKDSFGNIRFCGEEFGFSRLGHIIENDVIQWALWQQ
ASQSRDITLLAPATLRQVAWGENEAFITLEDGSMLTARLVVGADGAHSWLRQHADIPLTF
WDYGHHALVANIRTEQPHGAIASQVFHGDGILAFLPLSDPHLCSIVWSLPPERAQYMREL
PADDFVKQLAMTFDMRLGLCQLESDRQTFPLTARYARSFAAHRLVLTGDAAHTIHPLAGQ
GVNLGFMDVAELIAELKRLQTQGKDIGQHLYLRRYERRRKHSAALMLASMQGFRTLFAAS
HPVGGLLRDIGLKLADTLPGIKPTLVRQAMGLNDLPDWLDHAD