Protein Info for DDA3937_RS02280 in Dickeya dadantii 3937
Annotation: chorismate mutase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K04093, chorismate mutase [EC: 5.4.99.5] (inferred from 100% identity to ddd:Dda3937_02868)Predicted SEED Role
"Periplasmic chorismate mutase I precursor (EC 5.4.99.5)" in subsystem Chorismate Synthesis or Phenylalanine and Tyrosine Branches from Chorismate (EC 5.4.99.5)
MetaCyc Pathways
- superpathway of chorismate metabolism (54/59 steps found)
- superpathway of aromatic amino acid biosynthesis (18/18 steps found)
- superpathway of L-phenylalanine biosynthesis (10/10 steps found)
- superpathway of L-tyrosine biosynthesis (10/10 steps found)
- L-phenylalanine biosynthesis I (3/3 steps found)
- L-tyrosine biosynthesis I (3/3 steps found)
- L-phenylalanine biosynthesis II (3/4 steps found)
- L-tyrosine biosynthesis III (3/4 steps found)
- superpathway of L-phenylalanine and L-tyrosine biosynthesis (3/5 steps found)
- L-tyrosine biosynthesis II (2/4 steps found)
- bacilysin biosynthesis (1/10 steps found)
- salinosporamide A biosynthesis (3/15 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of phenylpropanoids
- Phenylalanine, tyrosine and tryptophan biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 5.4.99.5
Use Curated BLAST to search for 5.4.99.5
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See E0SJ47 at UniProt or InterPro
Protein Sequence (176 amino acids)
>DDA3937_RS02280 chorismate mutase (Dickeya dadantii 3937) MLRTMCLVACLISTNALAAESAYLASLVNQRLGYMKDVAGYKAAHHLAIEDLQQEDNVLK ASRQQATQYGLDADSVTPFIQAQMDAAKAIQYRYRADWLAVPEKDWQPRSLDEVRAQIAK LNGVLLQQLADTLHKQGGSLSHLNHAAFMHAVTQKNLSEHDKARLFTTLKQAKLQN