Protein Info for DDA3937_RS02230 in Dickeya dadantii 3937

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 101 to 122 (22 residues), see Phobius details amino acids 143 to 161 (19 residues), see Phobius details amino acids 167 to 185 (19 residues), see Phobius details amino acids 226 to 252 (27 residues), see Phobius details amino acids 272 to 297 (26 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 100 (100 residues), 44.9 bits, see alignment E=1.2e-15 PF00528: BPD_transp_1" amino acids 112 to 303 (192 residues), 146.1 bits, see alignment E=1.1e-46

Best Hits

Swiss-Prot: 45% identical to GSIC_SALPA: Glutathione transport system permease protein GsiC (gsiC) from Salmonella paratyphi A (strain ATCC 9150 / SARB42)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to ddd:Dda3937_01347)

MetaCyc: 44% identical to glutathione ABC transporter membrane subunit GsiC (Escherichia coli K-12 substr. MG1655)
RXN0-11 [EC: 7.4.2.10]

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SJ37 at UniProt or InterPro

Protein Sequence (305 amino acids)

>DDA3937_RS02230 ABC transporter permease (Dickeya dadantii 3937)
MVKYVFHRLLVALAVLFTVAAVSFSLLHLSGDLATAIAGPDATAETIAQIRVQNGLDKPL
LTQFSSWMWSALQLDFGRSFYFENTVMELVGQRMPVTLKLGGVSLLLALVLAIPLGVLAA
VFRDTWVDRLAMLVSVIGQAMPNFWFALVLILIFAVGLKWLPVAGNASWQNFVLPAVALG
YYAMPSLMRLTRSGMLDVLGSDYIRTARAKGLSAFKVVVKHGLRNAIIPVVALATVELGF
MLGGSVVIESVFSLQGLGQLAWDSISRNDFPVVQAIVLIIAVFYIGLTFLADVLNAALDP
RLRSK