Protein Info for DDA3937_RS01940 in Dickeya dadantii 3937

Annotation: ornithine carbamoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00658: ornithine carbamoyltransferase
  • amino acids 7 to 332 (326 residues), 437.9 bits, E=9.2e-136
• PF02729: OTCace_N
  • amino acids 7 to 147 (141 residues), 163.3 bits, E=4.2e-52
• PF00185: OTCace
  • amino acids 156 to 330 (175 residues), 179.4 bits, E=5.5e-57

Best Hits

Swiss-Prot: 86% identical to OTC_PECAS: Ornithine carbamoyltransferase (argI) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K00611, ornithine carbamoyltransferase [EC: 2.1.3.3] (inferred from 100% identity to ddd:Dda3937_01287)

MetaCyc: 80% identical to ornithine carbamoyltransferase ArgI (Escherichia coli K-12 substr. MG1655)
Ornithine carbamoyltransferase. [EC: 2.1.3.3]

Predicted SEED Role

"Ornithine carbamoyltransferase (EC 2.1.3.3)" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 2.1.3.3)

MetaCyc Pathways

• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis II (acetyl cycle) (9/10 steps found)
• superpathway of arginine and polyamine biosynthesis (14/17 steps found)
• L-citrulline degradation (3/3 steps found)
• L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
• L-arginine degradation XIII (reductive Stickland reaction) (3/5 steps found)
• urea cycle (3/5 steps found)
• L-citrulline biosynthesis (5/8 steps found)
• superpathway of L-citrulline metabolism (7/12 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)
• L-arginine degradation XIV (oxidative Stickland reaction) (1/6 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.3

Sequence Analysis Tools

See E0SI95 at UniProt or InterPro

Protein Sequence (338 amino acids)

>DDA3937_RS01940 ornithine carbamoyltransferase (Dickeya dadantii 3937)
MNPFYKRHFLRLMDFTPAEISSLLTLAATLKTNKKNGAEIRHLQGKNIALIFEKDSTRTR
CSFEVAAYDQGAQVTYLGPSGSQIGHKESMKDTARVLGRMYDGIQYRGYGQVLVETLAEF
SGVPVWNGLTNEFHPTQLLADLLTMQEHLPGKSLSGMALAYVGDTRNNMGNSMLEAAAIT
GLDLRLIAPKACWPDAGLVAECQAAAAKTGGSITLTEDVAAGVNGVDFIYTDVWVSMGEA
KEVWQQRIDLLRPYQVNAAMIAATGNPQVKFLHCLPAFHDDQTTLGKQMAEQYGLHNGME
VTNDVFESAHSIVFDQAENRMHTIKAVMVATLSHSVEI