Protein Info for DDA3937_RS01820 in Dickeya dadantii 3937

Annotation: tol-pal system-associated acyl-CoA thioesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 60 to 81 (22 residues), see Phobius details amino acids 170 to 191 (22 residues), see Phobius details amino acids 214 to 236 (23 residues), see Phobius details TIGR02797: tonB-system energizer ExbB" amino acids 49 to 260 (212 residues), 323.2 bits, see alignment E=4.2e-101 PF01618: MotA_ExbB" amino acids 142 to 240 (99 residues), 109.2 bits, see alignment E=6.3e-36

Best Hits

Swiss-Prot: 75% identical to EXBB_ECOLI: Biopolymer transport protein ExbB (exbB) from Escherichia coli (strain K12)

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 100% identity to ddd:Dda3937_01262)

MetaCyc: 75% identical to Ton complex subunit ExbB (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SI67 at UniProt or InterPro

Protein Sequence (282 amino acids)

>DDA3937_RS01820 tol-pal system-associated acyl-CoA thioesterase (Dickeya dadantii 3937)
MAFALLGMAGSALAAPASTPIATGTAAATTAAPSAPPGAVGSLMSTDLSVWGMYQHADVV
VKTVMIGLLLASVVTWAIFFGKSTSLMGAKKRIRREYQALEDARTLDDALDISGVFKPGS
VSLQLLADARNEQELSERSDDNNGIKERTAFRFERRVAATGRQMGRGTGYLATVGAIAPF
IGLFGTVWGIMNSFIGIAQSQTTNLAVVAPGIAEALLATAIGLVAAIPAVVIYNVFARWT
AGYKAMVGDVAAQILLLQSRDLDIAASAGNASSSPAQKLRVG