Protein Info for DDA3937_RS01600 in Dickeya dadantii 3937

Annotation: outer membrane-stress sensor serine endopeptidase DegS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR02038: periplasmic serine peptidase DegS" amino acids 2 to 351 (350 residues), 511.5 bits, see alignment E=6e-158 PF00089: Trypsin" amino acids 66 to 240 (175 residues), 78.3 bits, see alignment E=2e-25 PF13365: Trypsin_2" amino acids 80 to 214 (135 residues), 108.4 bits, see alignment E=1.4e-34 PF13180: PDZ_2" amino acids 258 to 346 (89 residues), 45 bits, see alignment E=2.9e-15 PF00595: PDZ" amino acids 263 to 334 (72 residues), 45.9 bits, see alignment E=1.5e-15 PF17820: PDZ_6" amino acids 282 to 323 (42 residues), 41.4 bits, see alignment 2.6e-14

Best Hits

Swiss-Prot: 69% identical to DEGS_ECO57: Serine endoprotease DegS (degS) from Escherichia coli O157:H7

KEGG orthology group: K04691, serine protease DegS [EC: 3.4.21.-] (inferred from 100% identity to ddd:Dda3937_00696)

MetaCyc: 69% identical to serine endoprotease (Escherichia coli K-12 substr. MG1655)
3.4.21.-

Predicted SEED Role

"Outer membrane stress sensor protease DegS" in subsystem Proteolysis in bacteria, ATP-dependent

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SHD7 at UniProt or InterPro

Protein Sequence (353 amino acids)

>DDA3937_RS01600 outer membrane-stress sensor serine endopeptidase DegS (Dickeya dadantii 3937)
MLTKLLRSALFGVIVAGILLLAIPALRSNQGLLKSGGDNSQETPVSYYQGVRRAAPAVVN
VYNQANDPTAKNELNIRTLGSGVIMNNKGYILTNKHVISNAEQIVVTLQDGRIFEALLVG
SDSLTDLAVLKIEGANLPEIPINPKRVFHVGDVVMAIGNPYNLGQTVTQGIVSATGRVGL
SSSGRQNFLQTDASINRGNSGGALVNTLGELVGINTLSFDKSNDGGTPEGIGFAIPVALA
TKIMNKLIRDGRVIRGYIGISGAQRERLGNQVTGLERLQGIVVNQVETGGPADKAGIKEG
DLLLEVNNKPARSVIETMDQVAEIRPGSVIPVVIFRDNQEIKLDMTIQEYPSD