Protein Info for DDA3937_RS01555 in Dickeya dadantii 3937

Annotation: arabinose-5-phosphate isomerase KdsD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 PF01380: SIS" amino acids 45 to 177 (133 residues), 113.1 bits, see alignment E=8.1e-37 TIGR00393: sugar isomerase, KpsF/GutQ family" amino acids 50 to 318 (269 residues), 402.6 bits, see alignment E=4.6e-125 PF00571: CBS" amino acids 207 to 261 (55 residues), 23 bits, see alignment E=8.1e-09 amino acids 273 to 325 (53 residues), 34.9 bits, see alignment 1.6e-12

Best Hits

Swiss-Prot: 83% identical to KDSD_YERPE: Arabinose 5-phosphate isomerase KdsD (kdsD) from Yersinia pestis

KEGG orthology group: K06041, arabinose-5-phosphate isomerase [EC: 5.3.1.13] (inferred from 100% identity to ddd:Dda3937_00687)

MetaCyc: 80% identical to D-arabinose 5-phosphate isomerase KdsD (Escherichia coli K-12 substr. MG1655)
Arabinose-5-phosphate isomerase. [EC: 5.3.1.13]

Predicted SEED Role

"Arabinose 5-phosphate isomerase (EC 5.3.1.13)" in subsystem KDO2-Lipid A biosynthesis (EC 5.3.1.13)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SHC8 at UniProt or InterPro

Protein Sequence (328 amino acids)

>DDA3937_RS01555 arabinose-5-phosphate isomerase KdsD (Dickeya dadantii 3937)
MSHFELQPGFDFQTAGRQVLSIERDSLAQLDQYIDDNFSRACEKMFYCHGKVVVMGMGKS
GHIGCKMAATFASTGTPAFFVHPGEASHGDLGMITAQDIVIAISNSGESHEILALIPVLK
RLQVCLICMTGNPESTMAKAADIHLCVHVSQEACPLGLAPTSSTTATLVMGDALAVALLQ
ARGFTAEDFALSHPGGALGRKLLLRINDIMHTGDEIPRVGRDASLRDALLEITRKNLGMT
VICGPDDRIEGIFTDGDLRRVFDMNIDLNSAGIADVMTRGGIRVTPQTLAVDALNLMQSR
HITSLLVAEDDRLRGIVHMHDMLRAGVV