Protein Info for DDA3937_RS01435 in Dickeya dadantii 3937

Annotation: rod shape-determining protein MreC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details TIGR00219: rod shape-determining protein MreC" amino acids 1 to 277 (277 residues), 378.3 bits, see alignment E=1.1e-117 PF04085: MreC" amino acids 123 to 269 (147 residues), 147.1 bits, see alignment E=1.7e-47

Best Hits

Swiss-Prot: 82% identical to MREC_ECOLI: Cell shape-determining protein MreC (mreC) from Escherichia coli (strain K12)

KEGG orthology group: K03570, rod shape-determining protein MreC (inferred from 100% identity to ddd:Dda3937_00663)

Predicted SEED Role

"Rod shape-determining protein MreC" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SHA4 at UniProt or InterPro

Protein Sequence (378 amino acids)

>DDA3937_RS01435 rod shape-determining protein MreC (Dickeya dadantii 3937)
MKPIFSRGPSLQLRLFLAVIIAIVIIFADSRLGTFVKIRTYMDTAVSPFYFLANGPRAML
DNLSANLTSREQLERENTALRQELLLKNSDLLLLGQFRQENARLRELLGSPLRQEEQKMV
TQVLSSGSDPYSDQVVIDKGNVNGVYEGQPVISDKGVVGQVVAVGQFTSRVLLICDASHA
LPIQVLRNDIRVIAAGNGCTEDLQLEHLPNNTDIRVGDVLVTSGLGGRFPEGYPVAVVSS
VKVDTQRAYTVIQARPTAELQRLRYLLLMWGVDSNSRTALPPDDVHRVANERLMQMMPHV
LPSPEEMGPPAPANTQAPDFVGPPAPPAKTTPVKTNSAAPSKPANATSPRNATTPAANPA
APSQQRATPAPGASGGSR