Protein Info for DDA3937_RS01165 in Dickeya dadantii 3937

Annotation: HesA/MoeB/ThiF family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00899: ThiF
  • amino acids 10 to 244 (235 residues), 229 bits, E=2e-72

Best Hits

Swiss-Prot: 63% identical to THIF_ECOLI: Sulfur carrier protein ThiS adenylyltransferase (thiF) from Escherichia coli (strain K12)

KEGG orthology group: K03148, adenylyltransferase [EC: 2.7.7.-] (inferred from 100% identity to ddd:Dda3937_00233)

MetaCyc: 63% identical to sulfur carrier protein ThiS adenylyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-9789 [EC: 2.7.7.73]

Predicted SEED Role

"Sulfur carrier protein adenylyltransferase ThiF" in subsystem Thiamin biosynthesis

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis I (10/10 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (6/6 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)

KEGG Metabolic Maps

• Biosynthesis of siderophore group nonribosomal peptides
• Lipopolysaccharide biosynthesis
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.-

Use Curated BLAST to search for 2.7.7.- or 2.7.7.73

Sequence Analysis Tools

See E0SGG7 at UniProt or InterPro

Protein Sequence (249 amino acids)

>DDA3937_RS01165 HesA/MoeB/ThiF family protein (Dickeya dadantii 3937)
MLDDQAFMRYSRQLLLEDIGQEGQQKLAAARVLLVGMGGLGSPAALYLAAAGVGTLLLAD
HDTLHISNLQRQILYRNADLSHPKAVLARHALEAVNPLVKTVALTTRLEGQPLEKAVAQA
DLVLDCCDNMTTRHAVNAACVAAQKPLISASAVGFSGQLLVLTPPYTHGCYACLYPDASE
PQRNCRTAGVLGPVVGVMGTLQALEAIKLLCGLPSPLDGKLRLFDARQHQWSTLQLTRSP
ACPVCGGLA