Protein Info for DDA3937_RS01155 in Dickeya dadantii 3937
Annotation: thiazole synthase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 83% identical to THIG_PECAS: Thiazole synthase (thiG) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
KEGG orthology group: K03149, thiamine biosynthesis ThiG (inferred from 100% identity to ddd:Dda3937_00231)MetaCyc: 77% identical to 1-deoxy-D-xylulose 5-phosphate:thiol sulfurtransferase (Escherichia coli K-12 substr. MG1655)
THIAZOLSYN2-RXN [EC: 2.8.1.10]
Predicted SEED Role
"Thiazole biosynthesis protein ThiG" in subsystem Thiamin biosynthesis
MetaCyc Pathways
- superpathway of thiamine diphosphate biosynthesis I (10/10 steps found)
- thiazole component of thiamine diphosphate biosynthesis I (6/6 steps found)
- superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
- thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.8.1.10
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See E0SGG5 at UniProt or InterPro
Protein Sequence (259 amino acids)
>DDA3937_RS01155 thiazole synthase (Dickeya dadantii 3937) MLKIADITFTSRLLTGTGKFSSAKLMQDALHASGSQLVTLAMKRVDLKSGSDAILAPLRE LGVHLLPNTSGAKTAEEAVFAARLAREALGTHWVKLEIHPDMKYLLPDPVETLKAAEQLV KDGFVVLPYCGADPVLCKRLEDAGCAAVMPLGAPIGSNQGLQTRDFLRIIIEQARVPVVV DAGIGAPSHAAEAIELGADAVLVNTAIAVARDPVQMAHAFRLAVDAGAIARQAGLGNRQR IASATSPLTGFLQHTEVAS