Protein Info for DDA3937_RS01095 in Dickeya dadantii 3937

Annotation: 50S ribosomal protein L7/L12

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00855: ribosomal protein bL12
  • amino acids 1 to 122 (122 residues), 161.3 bits, E=7e-52
• PF16320: Ribosomal_L12_N
  • amino acids 4 to 51 (48 residues), 62 bits, E=3.6e-21
• PF00542: Ribosomal_L12
  • amino acids 56 to 122 (67 residues), 105.7 bits, E=1.2e-34

Best Hits

Swiss-Prot: 97% identical to RL7_CROS8: 50S ribosomal protein L7/L12 (rplL) from Cronobacter sakazakii (strain ATCC BAA-894)

KEGG orthology group: K02935, large subunit ribosomal protein L7/L12 (inferred from 99% identity to dda:Dd703_3732)

MetaCyc: 91% identical to 50S ribosomal subunit protein L12 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L7/L12 (P1/P2)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

See E0SGF1 at UniProt or InterPro

Protein Sequence (122 amino acids)

>DDA3937_RS01095 50S ribosomal protein L7/L12 (Dickeya dadantii 3937)
MSITKDQIIEAVAAMSVMDVVELISAMEEKFGVSAAAAVAVASAGPAEAAEEKTEFDVIL
KAVGANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEAVSKDDAEALKKSLEEAGAEVE
VK