Protein Info for DDA3937_RS00950 in Dickeya dadantii 3937

Annotation: cystathionine gamma-synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02080: O-succinylhomoserine (thiol)-lyase
  • amino acids 3 to 382 (380 residues), 678.5 bits, E=1.1e-208
• PF01053: Cys_Met_Meta_PP
  • amino acids 6 to 381 (376 residues), 480 bits, E=4e-148
• PF00155: Aminotran_1_2
  • amino acids 57 to 178 (122 residues), 33 bits, E=4e-12

Best Hits

Swiss-Prot: 86% identical to METB_ECOLI: Cystathionine gamma-synthase (metB) from Escherichia coli (strain K12)

KEGG orthology group: K01739, cystathionine gamma-synthase [EC: 2.5.1.48] (inferred from 100% identity to ddd:Dda3937_03888)

MetaCyc: 86% identical to O-succinylhomoserine(thiol)-lyase / O-succinylhomoserine lyase (Escherichia coli K-12 substr. MG1655)
4.3.1.-; Cystathionine gamma-synthase. [EC: 2.5.1.48]

Predicted SEED Role

"Cystathionine gamma-synthase (EC 2.5.1.48)" in subsystem Methionine Biosynthesis (EC 2.5.1.48)

MetaCyc Pathways

• aspartate superpathway (24/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (18/18 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (9/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (9/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (8/8 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• L-methionine biosynthesis I (5/5 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (7/10 steps found)
• homocysteine and cysteine interconversion (2/4 steps found)
• superpathway of L-cysteine biosynthesis (fungi) (3/6 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Cysteine metabolism
• Methionine metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.48

Sequence Analysis Tools

See E0SGC8 at UniProt or InterPro

Protein Sequence (386 amino acids)

>DDA3937_RS00950 cystathionine gamma-synthase (Dickeya dadantii 3937)
MTRKQATIAVRSGLNNDEQFGCVVPPIHLSSTYNFTGFNEPRAHDYSRRGNPTRDVVQRA
LAELEGGAGAVMTSSGMSAILLVCTVFLRPGDLLVAPHDCYGGSYRLFDSLSKRGAYRVK
FVDQGNAADLKAALAEKPKLVLVESPSNPLLRVVDIAAICQAAREAGAVSVVDNTFLSPA
LQNPLKLGADLVVHSCTKYLNGHSDVVAGAVIARDPEVVTELAWWANNIGVTGAAFDSYL
LLRGVRTLSPRMMIAQKNALQIVEYLRHQPLVKALYHPSLPGNAGHEIARRQQSGFGAML
SFELDGDEDTLRRFLSTLELFTLAESLGGVESLISHAATMTHAGMAPQARAAAGISETLL
RISVGIEDGDDLVADLDRAFQAAAKR