Protein Info for DDA3937_RS00865 in Dickeya dadantii 3937

Annotation: triose-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF00121: TIM" amino acids 4 to 248 (245 residues), 330.8 bits, see alignment E=2.8e-103 TIGR00419: triose-phosphate isomerase" amino acids 5 to 240 (236 residues), 322.3 bits, see alignment E=1e-100

Best Hits

Swiss-Prot: 93% identical to TPIS_PECAS: Triosephosphate isomerase (tpiA) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K01803, triosephosphate isomerase (TIM) [EC: 5.3.1.1] (inferred from 100% identity to ddd:Dda3937_03871)

MetaCyc: 84% identical to triose-phosphate isomerase (Escherichia coli K-12 substr. MG1655)
Triose-phosphate isomerase. [EC: 5.3.1.1]

Predicted SEED Role

"Triosephosphate isomerase (EC 5.3.1.1)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or MLST (EC 5.3.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SFM5 at UniProt or InterPro

Protein Sequence (256 amino acids)

>DDA3937_RS00865 triose-phosphate isomerase (Dickeya dadantii 3937)
MRHPLVMGNWKLNGSTSMVHELIAGLRNELSAVTGCGVAIAPPAIYLDQAKHLLAGSRIA
LGAQNVDVNLAGAFTGETSAAMLKDIGAQYIIIGHSERRTYHHESDEFIAKKFAVLKETG
LIPVLCIGETEAENEAGQTEAVCARQLDAVLNTLGAKAFENTVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKQDAAVAEQVIIQYGGSVNAANAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAAEAKSQA