Protein Info for DDA3937_RS00685 in Dickeya dadantii 3937

Annotation: PLP-dependent aminotransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 36% identical to LYSN_THET2: 2-aminoadipate transaminase (lysN) from Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039)

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_02022)

MetaCyc: 36% identical to L-2-aminoadipate aminotransferase monomer (Thermus thermophilus)
2-aminoadipate transaminase. [EC: 2.6.1.39]

Predicted SEED Role

"Aromatic-amino-acid aminotransferase (EC 2.6.1.57)" in subsystem Homogentisate pathway of aromatic compound degradation (EC 2.6.1.57)

MetaCyc Pathways

superpathway of chorismate metabolism (54/59 steps found)
superpathway of aromatic amino acid biosynthesis (18/18 steps found)
superpathway of L-phenylalanine biosynthesis (10/10 steps found)
superpathway of L-tyrosine biosynthesis (10/10 steps found)
L-phenylalanine biosynthesis I (3/3 steps found)
L-tyrosine biosynthesis I (3/3 steps found)
L-phenylalanine biosynthesis III (cytosolic, plants) (2/2 steps found)
3-(4-hydroxyphenyl)pyruvate biosynthesis (1/1 steps found)
L-tyrosine degradation II (1/2 steps found)
atromentin biosynthesis (1/2 steps found)
L-phenylalanine degradation III (2/4 steps found)
L-tyrosine degradation III (2/4 steps found)
L-phenylalanine degradation II (anaerobic) (1/3 steps found)
L-tyrosine degradation IV (to 4-methylphenol) (1/3 steps found)
L-tyrosine degradation I (2/5 steps found)
superpathway of plastoquinol biosynthesis (2/5 steps found)
4-hydroxybenzoate biosynthesis I (eukaryotes) (1/5 steps found)
L-lysine degradation XI (1/5 steps found)
L-phenylalanine degradation VI (reductive Stickland reaction) (1/5 steps found)
L-tyrosine degradation V (reductive Stickland reaction) (1/5 steps found)
L-lysine biosynthesis IV (3/9 steps found)
L-lysine degradation V (3/9 steps found)
L-phenylalanine degradation IV (mammalian, via side chain) (3/9 steps found)
L-lysine biosynthesis V (3/10 steps found)
L-lysine degradation II (L-pipecolate pathway) (2/9 steps found)
rosmarinic acid biosynthesis I (1/10 steps found)
(S)-reticuline biosynthesis I (1/11 steps found)
tropane alkaloids biosynthesis (1/11 steps found)
superpathway of hyoscyamine (atropine) and scopolamine biosynthesis (3/16 steps found)
superpathway of rosmarinic acid biosynthesis (1/14 steps found)
anaerobic aromatic compound degradation (Thauera aromatica) (2/27 steps found)
superpathway of L-lysine degradation (12/43 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.57

Use Curated BLAST to search for 2.6.1.39 or 2.6.1.57

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SFI9 at UniProt or InterPro

Protein Sequence (394 amino acids)

>DDA3937_RS00685 PLP-dependent aminotransferase family protein (Dickeya dadantii 3937)
MSTDGLLAQRMARLKSSAIRELLKHSKMDGVISLAGGIPSDALFDFQGLNEATQLAITEQ
PKSAFQYGLTEGSPLLRERIAELCALRGVHTQAQDIVVTAGSQQALDLVMRATTNPQDIF
VVERPTYLAALQTLELAEAQVMSVSSDENGMVVDELAALLETTRIKGVYLVPNFGNPSGV
TLSDARRRQLVALAARHDFLIVEDDPYGELRFTEERHATLYQLAKEAGHADRVVYTSSFS
KILAPGLRLGWAILPDWLLHKVAIIKQAADLHASSLSQTIVEYYLGTGRLPAQIDKIRQA
YRQKGELLSELMASELGDVLSFNQPKGGMFLWARFRQPFDTTAWLQKTLAQGVVFVPGEF
FFADNPDQSTLRLSFATATEEQMHEAVARLRRAL