Protein Info for DDA3937_RS00670 in Dickeya dadantii 3937

Annotation: high-affinity branched-chain amino acid ABC transporter permease LivM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 45 to 65 (21 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details amino acids 118 to 151 (34 residues), see Phobius details amino acids 162 to 184 (23 residues), see Phobius details amino acids 193 to 210 (18 residues), see Phobius details amino acids 261 to 280 (20 residues), see Phobius details amino acids 313 to 333 (21 residues), see Phobius details amino acids 348 to 373 (26 residues), see Phobius details amino acids 385 to 401 (17 residues), see Phobius details PF11862: DUF3382" amino acids 5 to 103 (99 residues), 88.6 bits, see alignment E=2.7e-29 PF02653: BPD_transp_2" amino acids 111 to 398 (288 residues), 213.6 bits, see alignment E=3e-67

Best Hits

Swiss-Prot: 81% identical to LIVM_ECOLI: High-affinity branched-chain amino acid transport system permease protein LivM (livM) from Escherichia coli (strain K12)

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to ddd:Dda3937_02019)

MetaCyc: 81% identical to branched chain amino acid/phenylalanine ABC transporter membrane subunit LivM (Escherichia coli K-12 substr. MG1655)
ABC-15-RXN [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]; 7.4.2.2 [EC: 7.4.2.2]

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SFI6 at UniProt or InterPro

Protein Sequence (424 amino acids)

>DDA3937_RS00670 high-affinity branched-chain amino acid ABC transporter permease LivM (Dickeya dadantii 3937)
MKLHTLVNAVVSALVLLVLATFVMGMQLSLDGTQLVVHGAEKVRWMWIIAACVLVFLFQL
LRPVLAQGAKKVSGPGLVLPSFDGSTPRQKLLALALIIAAVAWPFVVSRGTVDIATLTMI
YIILGLGLNVVVGLSGLLVLGYGGFYAIGAYTYALLSHYYGLGFWQCLPLAGLTAALSGF
LLGFPVLRLRGDYLAIVTLGFGEIVRILLLNNTGFTGGPNGISQIPKPTFFGLEFSRSPR
EGGWDTFHHFFGLTYDPSDRIIFLYMVALLLVLLTLFVINRLLRMPLGRAWEALREDEIA
CRSLGLSPTKIKLTAFTISAAFAGFAGTLFAARQGFVSPESFTFVESAFVLAIVVLGGMG
SQFAVILAAILLVVSRELMRDLNEYSMLLLGALMVLMMIWRPQGLLPMKRTQIKLQVEKK
EEQA