Protein Info for DDA3937_RS00655 in Dickeya dadantii 3937

Annotation: aspartate 1-decarboxylase autocleavage activator PanM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 145 PF12568: PanZ" amino acids 3 to 131 (129 residues), 155.8 bits, see alignment E=6e-50 PF00583: Acetyltransf_1" amino acids 15 to 103 (89 residues), 34.7 bits, see alignment E=3e-12 PF13673: Acetyltransf_10" amino acids 29 to 103 (75 residues), 26.2 bits, see alignment E=1e-09

Best Hits

Swiss-Prot: 48% identical to PANZ_ECOLI: PanD regulatory factor (panZ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_02016)

MetaCyc: 48% identical to PanD maturation factor (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"probable acetyltransferase YPO3809"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SFI3 at UniProt or InterPro

Protein Sequence (145 amino acids)

>DDA3937_RS00655 aspartate 1-decarboxylase autocleavage activator PanM (Dickeya dadantii 3937)
MRLSVERLTKISEQDRHDLAFIWPHQNFDALERDLNHEHRLFAARFNDRLLAGVIVEIDN
NSDSAELTDLQVRTSTRRHGVGKYLVEEVLRACPDVKEWWLDAADHALVSEAVMDTFMQS
CGFYPVSGGWEYVVNQEKEMNREEK