Protein Info for DDA3937_RS00605 in Dickeya dadantii 3937

Annotation: 7-cyano-7-deazaguanine/7-aminomethyl-7- deazaguanine transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 37 to 60 (24 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 139 to 163 (25 residues), see Phobius details amino acids 183 to 205 (23 residues), see Phobius details TIGR00697: conserved hypothetical integral membrane protein" amino acids 12 to 204 (193 residues), 203.2 bits, see alignment E=2e-64 PF02592: Vut_1" amino acids 43 to 198 (156 residues), 121.5 bits, see alignment E=2.1e-39

Best Hits

Swiss-Prot: 72% identical to QPTR_ECOLI: Queuosine precursor transporter (yhhQ) from Escherichia coli (strain K12)

KEGG orthology group: K09125, hypothetical protein (inferred from 100% identity to ddd:Dda3937_02006)

MetaCyc: 72% identical to queuosine precursor transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-412

Predicted SEED Role

"Putative preQ0 transporter" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SFH3 at UniProt or InterPro

Protein Sequence (223 amino acids)

>DDA3937_RS00605 7-cyano-7-deazaguanine/7-aminomethyl-7- deazaguanine transporter (Dickeya dadantii 3937)
MFQFSAQQRLTALCWLSLFHILVIISSNYLVQLPITLFGFHTTWGAFTFPFIFLASDLTV
RIFGAPLARRIILTVMVPALVASYLVSSLFYKGEWQGFSALSQVNPMVARIAAASLMAYL
LGQILDVQVFNRLRRLKAWWVAPAASAVLGNLSDTVAFFFIAFYRSTDPFMATHWMEIAT
VDYFFKIAINLIFFLPMYGVLLNMVLRRLSQPGSNAPYQDQTA