Protein Info for DDA3937_RS00550 in Dickeya dadantii 3937

Annotation: endoglucanase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF01270: Glyco_hydro_8" amino acids 1 to 332 (332 residues), 542.1 bits, see alignment E=2.5e-167

Best Hits

Swiss-Prot: 100% identical to GUNY_DICD3: Minor endoglucanase Y (celY) from Dickeya dadantii (strain 3937)

KEGG orthology group: K01179, endoglucanase [EC: 3.2.1.4] (inferred from 100% identity to ddd:Dda3937_01994)

Predicted SEED Role

"Endoglucanase precursor (EC 3.2.1.4)" (EC 3.2.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.4

Use Curated BLAST to search for 3.2.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P27032 at UniProt or InterPro

Protein Sequence (332 amino acids)

>DDA3937_RS00550 endoglucanase (Dickeya dadantii 3937)
MGKPMWRCWALMLMVWFSASATAANGWEIYKSRFMTTDGRIQDTGNKNVSHTEGQGFAML
MAVHYDDRIAFDNLWNWTQSHLRNTTSGLFYWRYDPSAANPVVDKNNASDGDVLIAWALL
KAGNKWQDNRYLQASDSIQKAIIASNIIQFAGRTVMLPGAYGFNKNSYVILNPSYFLFPA
WRDFANRSHLQVWRQLIDDSLSLVGEMRFGQVGLPTDWAALNADGSMAPATAWPSRFSYD
AIRIPLYLYWYDAKTTALVPFQLYWRNYPRLTTPAWVDVLSSNTATYNMQGGLLAVRDLT
MGNLDGLSDLPGASEDYYSSSLRLLVMLARGK