Protein Info for DDA3937_RS00470 in Dickeya dadantii 3937

Annotation: dipeptide ABC transporter permease DppC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 32 to 53 (22 residues), see Phobius details amino acids 101 to 127 (27 residues), see Phobius details amino acids 146 to 171 (26 residues), see Phobius details amino acids 216 to 244 (29 residues), see Phobius details amino acids 264 to 286 (23 residues), see Phobius details PF12911: OppC_N" amino acids 17 to 69 (53 residues), 59.4 bits, see alignment 2.6e-20 PF00528: BPD_transp_1" amino acids 116 to 299 (184 residues), 114.2 bits, see alignment E=6.4e-37

Best Hits

Swiss-Prot: 85% identical to DPPC_ECO57: Dipeptide transport system permease protein DppC (dppC) from Escherichia coli O157:H7

KEGG orthology group: K12370, dipeptide transport system permease protein (inferred from 100% identity to ddd:Dda3937_02542)

MetaCyc: 85% identical to dipeptide ABC transporter membrane subunit DppC (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SER1 at UniProt or InterPro

Protein Sequence (300 amino acids)

>DDA3937_RS00470 dipeptide ABC transporter permease DppC (Dickeya dadantii 3937)
MTHVTESAATTAPKPMTPLQEFWHYFKRNKGAVVGLVYIILMLVVAIGASVLAPHSPAEQ
FRDALLKPPVWQEGGSWQYIFGTDDVGRDVLSRLMYGARLSLLVGCLVVVMSLILGVVFG
LVAGYFGGAVDAAIMRLVDIMLALPSLLLALVLVAIFGPSIVNASLALTFVSLPHYVRLT
RAAVLVEVNRDYVTASRVAGAGPLRQMFVNILPNCLAPLIVQASMGFSNAILDMAALGFL
GMGAQPPTPEWGTMLSDVLQFAQSAWWVVTFPGLAILLTVLAFNLMGDGLRDALDPKLKQ