Protein Info for DDA3937_RS00430 in Dickeya dadantii 3937

Annotation: heat shock chaperone IbpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 PF00011: HSP20" amino acids 42 to 137 (96 residues), 71.8 bits, see alignment E=2.2e-24

Best Hits

Swiss-Prot: 85% identical to IBPA_PECCP: Small heat shock protein IbpA (ibpA) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K04080, molecular chaperone IbpA (inferred from 100% identity to ddd:Dda3937_02534)

Predicted SEED Role

"16 kDa heat shock protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SEQ3 at UniProt or InterPro

Protein Sequence (137 amino acids)

>DDA3937_RS00430 heat shock chaperone IbpA (Dickeya dadantii 3937)
MRNPDFSPLYRSAIGFDRLFNLLEAGQSQGNGGYPPYNVELVDENQYRIAIAVAGFAESE
LEITAHDNMLIVKGSHSGDATPRNYLYQGIAERNFERKFQLAEHIQINGANLENGLLFID
LQRVIPETLKPRRIEIK