Protein Info for DDA3937_RS00315 in Dickeya dadantii 3937

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 PF00005: ABC_tran" amino acids 19 to 161 (143 residues), 131.1 bits, see alignment E=7.1e-42 PF08402: TOBE_2" amino acids 270 to 341 (72 residues), 38.5 bits, see alignment E=1.5e-13

Best Hits

Swiss-Prot: 46% identical to UGPC1_AGRFC: sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 (ugpC1) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02023, multiple sugar transport system ATP-binding protein (inferred from 100% identity to ddd:Dda3937_01153)

Predicted SEED Role

"Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SEM9 at UniProt or InterPro

Protein Sequence (367 amino acids)

>DDA3937_RS00315 ABC transporter ATP-binding protein (Dickeya dadantii 3937)
MAEIVLDGVTKAWGDTPVLHPVNLTLADGEFVAILGPSGCGKSTTLFLLAGLYAPTQGQI
LFDGQRVNGVDARDRNVGVVFQSYALYPHLSVYDNIAFPLRFKPAERAERDQRVREAAAL
VQVTELLERKPSALSGGQQQRVALARALVKRPSLLLLDEPLSNLDATLRMTMRTELKAIH
ARSRATTLMVTHDQLEAMTLASRIICMNQGRVEQIGTPQQLYRQPANTFVAGFIGSPPIC
LLPGQANGRWLTVGEISWGLSSTYHGALTLGIRPEDVTLTPLGAGPLSGRIEHIEPMGRE
VLYRLHTSLGPLQALAAGSTAQYDAGMLVGVSPSVDALLLFDADGNRLPDVGVVLPADVV
SACRTAG