Protein Info for DDA3937_RS00245 in Dickeya dadantii 3937

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 60 to 85 (26 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 146 to 171 (26 residues), see Phobius details amino acids 192 to 214 (23 residues), see Phobius details amino acids 253 to 275 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 75 to 279 (205 residues), 81.5 bits, see alignment E=3.5e-27

Best Hits

Swiss-Prot: 33% identical to UGPA_PECAS: sn-glycerol-3-phosphate transport system permease protein UgpA (ugpA) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to ddd:Dda3937_01139)

Predicted SEED Role

"N-Acetyl-D-glucosamine ABC transport system, permease protein 1" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SEL4 at UniProt or InterPro

Protein Sequence (282 amino acids)

>DDA3937_RS00245 sugar ABC transporter permease (Dickeya dadantii 3937)
MGFGFIAPLLIPLLLFWVIPFFCSLYISLTDWDYISPDYHLVGVDNYRDLLLSDDFTGAL
VNTLTFAIAVVIPVVVLGLGFALLLHRQCRGQRCYQAMIFSPWITPTVAVSVVWSWVFDS
RAGLANQLLGLFGVAGVPWLERPGSAMLAVVIVTVWQGIGWTMMFFISALNRIPAELYEA
ARLDGGSRARRLLTITLPLISPTTFFLLIVNLVNAVQAFDQFQMLTQGGPGNSTRTLMYL
FYQQAFQQFSMGPAAATAVMILLLAGSLSLVNTLIARRWVYF