Protein Info for DDA3937_RS00225 in Dickeya dadantii 3937

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 43 to 65 (23 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 165 to 189 (25 residues), see Phobius details amino acids 197 to 217 (21 residues), see Phobius details amino acids 237 to 258 (22 residues), see Phobius details amino acids 267 to 287 (21 residues), see Phobius details amino acids 293 to 313 (21 residues), see Phobius details amino acids 322 to 345 (24 residues), see Phobius details amino acids 357 to 375 (19 residues), see Phobius details PF07690: MFS_1" amino acids 16 to 235 (220 residues), 45.3 bits, see alignment E=5.8e-16 amino acids 207 to 378 (172 residues), 50.7 bits, see alignment E=1.3e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to ddd:Dda3937_01135)

Predicted SEED Role

"Transporter, MFS superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SEL0 at UniProt or InterPro

Protein Sequence (392 amino acids)

>DDA3937_RS00225 MFS transporter (Dickeya dadantii 3937)
MSTSRRAHQLAILVVMISASLVGLVQGYSIPLVTLKLTALGYGSALTGMMSALPAIGVFV
SSWVAAPVAMRLPVGRLLALSTWGMGVSLTLSFYLDNVALLAAPRFLMGFCCGLIIVIGE
SWVSGHTAEHRRGVLVGLYATAFTGLQLLGPLLISLTGLDDPTGLLLILALHGVCLLMVP
GSSFSGLALSAHRQHNLFSLLLAAPALAAAVFAFAFFDGAVLSMLPLYGMAHGYEEQLAV
LLVTVLFIGDALLQVPLGWVSDKLGTVRVHLACGGLFVLMLVGLPFSYGTGWVWANVFLL
GAVAGSIYTLALVRAGKQFSGVNLVAINALFGVLWGVGSFSGPLVSGSLMQWYGRDGLIA
VLGVLGLLFLAANALSATQRNAAGQTDPELAE