Protein Info for DDA3937_RS00200 in Dickeya dadantii 3937

Annotation: kdo(2)-lipid A phosphoethanolamine 7''-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 560 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 50 to 68 (19 residues), see Phobius details amino acids 80 to 108 (29 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 204 to 219 (16 residues), see Phobius details PF08019: EptA_B_N" amino acids 61 to 198 (138 residues), 58.1 bits, see alignment E=1e-19 PF00884: Sulfatase" amino acids 251 to 540 (290 residues), 184.4 bits, see alignment E=3.3e-58

Best Hits

Swiss-Prot: 63% identical to EPTB_ECOLI: Kdo(2)-lipid A phosphoethanolamine 7''-transferase (eptB) from Escherichia coli (strain K12)

KEGG orthology group: K12975, phosphoethanolamine transferase (inferred from 100% identity to ddd:Dda3937_01131)

MetaCyc: 63% identical to phosphoethanolamine transferase EptB (Escherichia coli K-12 substr. MG1655)
RXN-16286 [EC: 2.7.8.42]; 2.7.8.42 [EC: 2.7.8.42]; 2.7.8.42 [EC: 2.7.8.42]

Predicted SEED Role

"Phosphoethanolamine transferase specific for the outer Kdo residue of lipopolysaccharide" in subsystem Lipid A modifications

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.42

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SEK6 at UniProt or InterPro

Protein Sequence (560 amino acids)

>DDA3937_RS00200 kdo(2)-lipid A phosphoethanolamine 7''-transferase (Dickeya dadantii 3937)
MKSLLALSQSKLSWLLAIYIGFFLNLPVFYRRVDAFPFFTENPVAKYIPLLVESMACILF
TFFLMRILSLGGRRFFRVMASLLVLISVAASYYMTFFNVVIGYGIIAAVMTTDIDLSKEV
VGLFFVLWVAALSLPPVFLIWKNRLQQTLIEQLRTSGRRRIALLGLVASAALVWLPLRYL
AQINTSAEKLSNQDLPSYGGVVAHSYLPANWLSAFGLFAYARYDENQDDDELIDPSKQFT
YQAPPGIDDTYVVFIIGETTRWDHMGLLGYERDTTPQLAKEKNLLAFRGHSCDTSTKLSM
RCMFVREGGTSDNPQRTLREKNIFAVMKSLGFSSELFAMQSEVWFYNNIQADNYAFREMI
ASEKRNEGKAVDDMLLVDEMSQSLMRYPNGKHLVVLHTKGSHYLYSMRYPRSYARYQPEC
MGVDASCSREQLINAFDNSVLYTDAVIKRVIDQLRDKKALLVYASDHGESIDDNYHLHGT
PRQMAPPEQFRSPIMLWASDKYLAQPRNQQAFEQLRAQQQQGKVLRHEEIFDSMLGCLGY
TSPDGGIQEKNNWCNMPGRG