Protein Info for DDA3937_RS00190 in Dickeya dadantii 3937

Annotation: guanylate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03263: guanylate kinase
  • amino acids 4 to 184 (181 residues), 253 bits, E=6.7e-80
• PF00625: Guanylate_kin
  • amino acids 5 to 185 (181 residues), 226.6 bits, E=1e-71

Best Hits

Swiss-Prot: 90% identical to KGUA_PECAS: Guanylate kinase (gmk) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K00942, guanylate kinase [EC: 2.7.4.8] (inferred from 100% identity to ddd:Dda3937_01129)

MetaCyc: 87% identical to guanylate kinase (Escherichia coli K-12 substr. MG1655)
Guanylate kinase. [EC: 2.7.4.8]; T(2)-induced deoxynucleotide kinase. [EC: 2.7.4.8, 2.7.4.12, 2.7.4.13]

Predicted SEED Role

"Guanylate kinase (EC 2.7.4.8)" in subsystem MLST or Purine conversions (EC 2.7.4.8)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (26/26 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (14/14 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (8/8 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (7/7 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
• superpathway of pyrimidine deoxyribonucleoside salvage (8/9 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• pyrimidine deoxyribonucleotide phosphorylation (4/4 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (6/8 steps found)
• purine deoxyribonucleosides salvage (4/6 steps found)
• dZTP biosynthesis (3/5 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.4.8

Use Curated BLAST to search for 2.7.4.12 or 2.7.4.13 or 2.7.4.8

Sequence Analysis Tools

See E0SEK4 at UniProt or InterPro

Protein Sequence (207 amino acids)

>DDA3937_RS00190 guanylate kinase (Dickeya dadantii 3937)
MAQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSISHTTRAMRPGEVHGEHYFFVPVD
EFKRMIEEDDFLEYAEVFGNYYGTSRAAIEQVLSTGVDVFLDIDWQGARQIRERMPQARS
IFILPPSQEELERRLRGRGQDSEEVIARRMKQAVAEMSHYAEYDYLIVNDDFDLALLDLK
TIIRAERLRLSRQKVRHDALITKLLAD