Protein Info for DDA3937_RS00100 in Dickeya dadantii 3937

Annotation: thiol:disulfide interchange protein DsbA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13462: Thioredoxin_4
  • amino acids 40 to 182 (143 residues), 39.4 bits, E=7.3e-14
• PF01323: DSBA
  • amino acids 40 to 196 (157 residues), 107.6 bits, E=7.3e-35

Best Hits

Swiss-Prot: 100% identical to DSBA_DICD3: Thiol:disulfide interchange protein DsbA (dsbA) from Dickeya dadantii (strain 3937)

KEGG orthology group: K03673, thiol:disulfide interchange protein DsbA (inferred from 100% identity to ddd:Dda3937_01111)

MetaCyc: 69% identical to thiol:disulfide oxidoreductase DsbA (Escherichia coli K-12 substr. MG1655)
RXN-21426 [EC: 1.8.4.15]; 1.8.4.15 [EC: 1.8.4.15]

Predicted SEED Role

"Periplasmic thiol:disulfide interchange protein DsbA" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

MetaCyc Pathways

• periplasmic disulfide bond formation (1/3 steps found)
• cytochrome c biogenesis (system I type) (4/11 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.15

Sequence Analysis Tools

See P52234 at UniProt or InterPro

Protein Sequence (207 amino acids)

>DDA3937_RS00100 thiol:disulfide interchange protein DsbA (Dickeya dadantii 3937)
MKKLWLALAGMVLAFSASAADFSDGKQYATLDKPVPQSPQVLEFFSFYCPHCYQFAQVYH
IPDAIQKALPADAKLTKYHVDFLGELGKELTQAWAVAIALGVEDKVSPLMFDAVQKTQTV
KQPQDIRQVFVAAGVKAEDYDSALNSFVVKSLVAQQEKAAADLQLRGVPAVFVNGKYMIK
SDGLDTSSMDNYVKQYADVVKFLLSQK