Protein Info for DDA3937_RS00055 in Dickeya dadantii 3937

Annotation: ribose operon transcriptional repressor RbsR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 PF00356: LacI" amino acids 3 to 48 (46 residues), 81.4 bits, see alignment 6.4e-27 PF00532: Peripla_BP_1" amino acids 60 to 318 (259 residues), 121.6 bits, see alignment E=9e-39 PF13407: Peripla_BP_4" amino acids 62 to 305 (244 residues), 79 bits, see alignment E=9e-26 PF13377: Peripla_BP_3" amino acids 170 to 330 (161 residues), 152 bits, see alignment E=3.5e-48

Best Hits

Swiss-Prot: 70% identical to RBSR_SHIFL: Ribose operon repressor (rbsR) from Shigella flexneri

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 100% identity to ddd:Dda3937_02360)

Predicted SEED Role

"Ribose operon repressor" in subsystem D-ribose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SDU2 at UniProt or InterPro

Protein Sequence (334 amino acids)

>DDA3937_RS00055 ribose operon transcriptional repressor RbsR (Dickeya dadantii 3937)
MATMKDVARLAGVSTSTVSHVINNNRYVSDAIRDRVMKAVEELNYAPSALARSLKINQTR
TIGMLLTASSNPFYAEVVRGVERCCYERGYSLILCNTEGDHHRLSRSLETLLQKRVDGLL
LMCTESHMPSPDIIRRYPSIPVVMMDWAPFEGSSDVIKDNSLQGGEMATHYLISQGYRNI
ACIAGPQDKTTAHNRLEGYRKAMYQAGLPILPGYEVVGDFEFETGFRAMQQLLALPERPD
AVFTSNDAMAVGVYRALHDAGLSIPDDMAVVGYDDIELARYLSPPLTTIHQPKDELGELA
IDTLLHRLEHPDTEHNVLVLTPELIVRDSVGKRS