Protein Info for DDA3937_RS00020 in Dickeya dadantii 3937

Annotation: ATPase RavA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 498 PF20030: bpMoxR" amino acids 11 to 195 (185 residues), 188.9 bits, see alignment E=1.9e-59 PF07728: AAA_5" amino acids 42 to 171 (130 residues), 95.6 bits, see alignment E=8.4e-31 PF17868: AAA_lid_8" amino acids 229 to 296 (68 residues), 75.7 bits, see alignment E=6.2e-25 PF20265: LARA_dom" amino acids 334 to 436 (103 residues), 132.9 bits, see alignment E=1.5e-42 PF12592: ATPase_RavA_C" amino acids 443 to 496 (54 residues), 80.8 bits, see alignment 1.7e-26

Best Hits

Swiss-Prot: 75% identical to RAVA_PECCP: ATPase RavA (ravA) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K03924, MoxR-like ATPase [EC: 3.6.3.-] (inferred from 100% identity to ddd:Dda3937_00158)

MetaCyc: 66% identical to regulatory ATPase RavA (Escherichia coli K-12 substr. MG1655)
Non-chaperonin molecular chaperone ATPase. [EC: 3.6.4.10, 5.6.1.7]

Predicted SEED Role

"Putative regulator protein"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 3.6.4.10 or 5.6.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E0SDT5 at UniProt or InterPro

Protein Sequence (498 amino acids)

>DDA3937_RS00020 ATPase RavA (Dickeya dadantii 3937)
MIQPTALADRISRLSHALEHGLYERQHAIRLCLLAALSGESVFLLGPPGIAKSLIARRLK
YAFRHARAFEYLMTRFSTPEEVFGPLSIQALKDEGRYQRLTTGYLPEAEIVFLDEIWKAG
PAILNTLLTAINERRFRNGNSEEPIPMRLLVTASNELPEADSSLEALYDRMLIRIWLDRV
QDKHNFRAMLTASPGEQDNLVSPALSVSDEEYQQWQSHIDHIPLPENCFELIYQLRQRLD
SQDGSPYVSDRRWKKAIRLLQACAFFSGRETITPVDLILLKDCLWHDLGTHDLVEQQLQQ
LMSEQAYQQRALLYRLQQLNVKRQQYQQQQSEQQAFRVERQVNFFGRKPHHTLPESLTST
ELTLMLQKPLLLNDYTVTHVVLDREALAGWLQKGGEIRGKLNGVGFSQRLDMEVDERQHL
IIRDISLQSTVLSLPGVLKGELPEEMLQEYETLKIQLREQRRLFERHQPCLFVPKEWLAR
IEESLQQVDEQIEQSQRE