Protein Info for COO64_RS23260 in Pseudomonas sp. SVBP6

Annotation: p-hydroxyphenylacetate 3-hydroxylase reductase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 PF01613: Flavin_Reduct" amino acids 17 to 158 (142 residues), 147.9 bits, see alignment E=1.3e-47

Best Hits

Swiss-Prot: 55% identical to HPAHR_ACIBA: p-hydroxyphenylacetate 3-hydroxylase, reductase component (C1-hpah) from Acinetobacter baumannii

KEGG orthology group: None (inferred from 82% identity to pba:PSEBR_a2735)

Predicted SEED Role

"P-hydroxyphenylacetate hydroxylase C1:reductase component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>COO64_RS23260 p-hydroxyphenylacetate 3-hydroxylase reductase component (Pseudomonas sp. SVBP6)
MSSATAFDSRAFRRALGNFATGVTVVTAADPRGNLVGVTANSFNSVSLDPPLILWSLDKR
SSSLAVFEAASHFAVNILAADQIDLSNNFAKPKDDRFAGISYQAGEGGAPILADCSACFE
CETHQILDGGDHWIMLGKVVAFDDCGRSPLLYHQGAYSMVLPHTRMTRREEGQPPSSHFQ
GRLSHNLYYLMTQALRAYQSSYQPRQLSSGLRTSEARMLMVLENDAGLNLADLQREVAMP
AREIDEAVANLKRKGLVCDSQAAGHVRLTSAGIDQTEGLWSIAREQQDKVFGTFSEEQIA
TFKTVLQAVIRSC