Protein Info for COO64_RS21480 in Pseudomonas sp. SVBP6

Name: vioA
Annotation: dTDP-4-amino-4,6-dideoxy-D-glucose aminotransferase VioA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 59% identical to VIOA_SHIDY: dTDP-4-amino-4,6-dideoxy-D-glucose transaminase (vioA) from Shigella dysenteriae

KEGG orthology group: None (inferred from 81% identity to pba:PSEBR_a1452)

MetaCyc: 37% identical to dTDP-4-amino-4,6-dideoxy-D-glucose transaminase (Saccharopolyspora erythraea NRRL 2338)
dTDP-4-amino-4,6-dideoxy-D-glucose transaminase. [EC: 2.6.1.33]

Predicted SEED Role

"Aminotransferase, DegT/DnrJ/EryC1/StrS family"

MetaCyc Pathways

dTDP-N-acetylviosamine biosynthesis (3/4 steps found)
dTDP-D-desosamine biosynthesis (3/6 steps found)
superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (6/19 steps found)
superpathway of erythromycin biosynthesis (3/19 steps found)
superpathway of megalomicin A biosynthesis (4/22 steps found)

KEGG Metabolic Maps

Polyketide sugar unit biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.33

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (383 amino acids)

>COO64_RS21480 dTDP-4-amino-4,6-dideoxy-D-glucose aminotransferase VioA (Pseudomonas sp. SVBP6)
MAESVPVTSPLLPPLEEFIPYLQQIWDSKRLTNGGPFHEQLEQELADYLGVKHISLFSNG
TLALVTALQALRITGEVITTPYSFVATAHSLLWNNLKPVFVDIDPLTNNLDPKRVEEAIT
SATTAILPVHCYGIPCDVEGIQRVADTYGLKVIYDAAHAFGVRDNGASVLNHGDLSILSF
HATKVFNTFEGGAIICPDAKIKQRIDYLKNFGFADEVTVMAPGINGKMNEVQAAFGLLQL
RHIDDALVRRRAVFERYRQALEGVPGVRLLEPPAGLEWNYAYCPILIDAERFGCSRDALY
QRYRDQDILVRRYFYPLINEFPMYRGLPSADLSGLPHAWQVSRQVLCLPIHPQLSTEIQQ
QIIDLALACHAEQTRSSSTALEL