Protein Info for COO64_RS12315 in Pseudomonas sp. SVBP6

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 29 to 167 (139 residues), 122.1 bits, E=1.3e-39

Best Hits

Swiss-Prot: 44% identical to SSUB_BACCZ: Aliphatic sulfonates import ATP-binding protein SsuB (ssuB) from Bacillus cereus (strain ZK / E33L)

KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 78% identity to pfl:PFL_0206)

Predicted SEED Role

"Alkanesulfonates ABC transporter ATP-binding protein / Sulfonate ABC transporter, ATP-binding subunit SsuB" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Protein Sequence (274 amino acids)

>COO64_RS12315 ABC transporter ATP-binding protein (Pseudomonas sp. SVBP6)
MNAIAPALVSFNQVGKHFAVAGGELEAIRDFNLQIADGEFVAIVGASGCGKSTLLRLLIG
LDNDYQGQILIDGQPLNGIGSERGIVFQEHRLFPWLSVAQNIALGLVNAPLNSEQRQQRI
DQYIALVGLQDFSQAYPHQLSGGMAQRVAIARGLVASPRILLLDEPFGALDALTRQQMQD
ELLAIRERARITTLLVTHDVEEALFLADRVVVLEPRPGRIKRIVDIDLAHPRQRGSYAFH
RLREDLLHELTADERYLPPALEQIRDLPLTYLAY