Protein Info for COO64_RS07115 in Pseudomonas sp. SVBP6

Name: rdgC
Annotation: recombination-associated protein RdgC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04381: RdgC
  • amino acids 1 to 300 (300 residues), 381.1 bits, E=1.9e-118

Best Hits

Swiss-Prot: 89% identical to RDGC_PSE14: Recombination-associated protein RdgC (rdgC) from Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)

KEGG orthology group: K03554, recombination associated protein RdgC (inferred from 89% identity to psp:PSPPH_1571)

Predicted SEED Role

"DNA recombination-dependent growth factor C" in subsystem CBSS-562.2.peg.5158 SK3 including or DNA repair, bacterial

Protein Sequence (306 amino acids)

>COO64_RS07115 recombination-associated protein RdgC (Pseudomonas sp. SVBP6)
MWFKNLLTYRLTQDIPFDPEALETALASKPARPCASQELTTYGFIAPFGKGEDAPLVHVS
GDFLLIAARKEERILPGSVVRDAVKEKIDEIEAEQMRKVYKKERDQIKDEIIQAFLPRAF
IRRSMIFAAIAPKQGLILVNSASAKRAEDLLSTLREVIGSLPVRPVTVKIAPSATMTDWV
KTQQAAPDFYVLDECELRDTHEDGGIVRCKRQDLTSDEIQLHLGTGKVVTQLSLAWQDKL
SFVLDDKMVIKRLRFEELLQDQAEEDGGDEALGQLDASFTLMMLTFGEFLPALFEALGGE
EIPQGI